PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g24666.1.p
Common NameBRADI_4g24666
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 507aa    MW: 59095.8 Da    PI: 8.2431
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g24666.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR157.44.7e-181197191
              FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91
                      ++Y++YAk  GF v++++s++  +ng+ +  t++Cs++gk+e+++k+     +++++   gCkak+++ +  dg+++++++ ++HnH+l+p
  Bradi4g24666.1.p 11 QYYKNYAKAKGFGVTRRSSNRD-DNGQLKYLTLCCSCHGKTESNSKN---MLKPNPTAGLGCKAKVNIVRGPDGTFHLSTVISDHNHTLSP 97
                      69***************99998.8889****************9999...999***********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.3E-151197IPR004330FAR1 DNA binding domain
PfamPF105511.6E-34217311IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MTFDTENDVR QYYKNYAKAK GFGVTRRSSN RDDNGQLKYL TLCCSCHGKT ESNSKNMLKP  60
NPTAGLGCKA KVNIVRGPDG TFHLSTVISD HNHTLSPHTS RLFRCNKRLN FNVKRRLELN  120
DRAGIRVNKN FNSLVVAADG HENLTFGEKE CRNYLEKTRR LKFGSGDAEA VRDYFMKMQS  180
DNPKFFSLMD VDDESRLKNV FWADARSRAV YDSFDDVITF DTTYLVNKYD MPFASFVGVN  240
HHGQYALLGC ALLSNEDTQT FVWLFQAWLT CTSNRQPRAI VTDQAKAIQN AVEIVFPDAR  300
YRWCLWHIMK KLPEKLGGYE QYEYIKTAIG KSVYDSLTIT DFEGSWMRMR MLVRYDIAGN  360
EWLKGLYDNR HRWVPAFVKD VFWAGISTTQ RSESMHAFFD GYVNVKTTLK HFVSQYENAL  420
HDKVEKEILD DFNSFHSTIP RITHFDIEKQ FQSVYTNSQF KEFQEELTHM LYCDRNFIQK  480
EGAIEIYKIT EDVLIDKDEG WRKDYR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756066.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like
TrEMBLA0A0Q3EP550.0A0A0Q3EP55_BRADI; Uncharacterized protein
STRINGBRADI2G36810.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.11e-100FAR1 family protein